PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.M6NI0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 323aa    MW: 37163.1 Da    PI: 8.0281
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.M6NI0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092532872155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Aradu.M6NI0 253 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 287
                  569*****************************885 PP

2ELK34.15.9e-12207228122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLl+KYsgyLg+Lk+EF+
  Aradu.M6NI0 207 ELKIQLLKKYSGYLGGLKKEFL 228
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037903.1E-96689IPR005540KNOX1
SMARTSM012566.6E-23112163IPR005541KNOX2
PfamPF037915.6E-20115161IPR005541KNOX2
PfamPF037896.5E-9207228IPR005539ELK domain
PROSITE profilePS5121310.737207227IPR005539ELK domain
SMARTSM011885.5E-6207228IPR005539ELK domain
PROSITE profilePS5007112.228227290IPR001356Homeobox domain
SMARTSM003892.8E-12229294IPR001356Homeobox domain
SuperFamilySSF466892.1E-19229301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28232293IPR009057Homeodomain-like
CDDcd000861.10E-12239291No hitNo description
PfamPF059202.9E-17247286IPR008422Homeobox KN domain
PROSITE patternPS000270265288IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MNSDSNKFLS SIMATVINKN TNNSSSSSPS TFNMPHHHNY TSHHQQQQQT ATNTNSNGAG  60
SSSVQVRDKI MAHPLFPRLL SSYLNCLKVI IIIIIIINIS ILSYNKLHIS DSNSCIGEDP  120
GLDQFMEAYC EMLIKYEQEI SKPFKEAMLF FSTIDSQLKA LSLSPHFGTN HQSESSSSLL  180
QNEVDVLDEN NNNNRNMDTS QAEEDRELKI QLLKKYSGYL GGLKKEFLKK KKNGKLPKEA  240
RQQLLDWWNR HYKWPYPSES QKQALAESTG LDLKQINNWF INQRKRHWKP SEDMQFAVMD  300
ATNHYMETIM CKPFPMDTMP ILF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015973573.11e-171PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-93HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA5Y4H11e-121A5Y4H1_MEDTR; Class I KNOX homeobox transcription factor
TrEMBLD4NXR41e-121D4NXR4_MEDTR; Homeobox knotted-like protein
STRINGGLYMA14G05150.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.19e-75KNOX/ELK homeobox transcription factor